PDB entry 6dhm

View 6dhm on RCSB PDB site
Description: Bovine glutamate dehydrogenase complexed with zinc
Class: oxidoreductase
Keywords: glutamate, dehydrogenase, zinc, inhibition, OXIDOREDUCTASE
Deposited on 2018-05-20, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhma1, d6dhma2
  • Chain 'B':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhmb1, d6dhmb2
  • Chain 'C':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhmc1, d6dhmc2
  • Chain 'D':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhmd1, d6dhmd2
  • Chain 'E':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhme1, d6dhme2
  • Chain 'F':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhmf1, d6dhmf2
  • Heterogens: GLU, NDP, GTP, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dhmA (A:)
    lppsvsgpvrapllrglrpaamyrclgealllsrigpaalgsvaadsavllgrargqaaa
    avaapqpglvpparrhyseaaadreddpnffkmvegffdrgasivedklvedlktretee
    qkrnrvrgilriikpcnhvlslsfpirrddgsweviegyraqhsqhrtpckggirystdv
    svdevkalaslmtykcavvdvpfggakagvkinpknytdnelekitrrftmelakkgfig
    pgvdvpapdmstgeremswiadtyastighydinahacvtgkpisqggihgrisatgrgv
    fhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgs
    iwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaasekqltksnaprv
    kakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltf
    kyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdivhsglaytmer
    sarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dhmA (A:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dhmB (B:)
    lppsvsgpvrapllrglrpaamyrclgealllsrigpaalgsvaadsavllgrargqaaa
    avaapqpglvpparrhyseaaadreddpnffkmvegffdrgasivedklvedlktretee
    qkrnrvrgilriikpcnhvlslsfpirrddgsweviegyraqhsqhrtpckggirystdv
    svdevkalaslmtykcavvdvpfggakagvkinpknytdnelekitrrftmelakkgfig
    pgvdvpapdmstgeremswiadtyastighydinahacvtgkpisqggihgrisatgrgv
    fhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgs
    iwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaasekqltksnaprv
    kakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltf
    kyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdivhsglaytmer
    sarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dhmB (B:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dhmC (C:)
    lppsvsgpvrapllrglrpaamyrclgealllsrigpaalgsvaadsavllgrargqaaa
    avaapqpglvpparrhyseaaadreddpnffkmvegffdrgasivedklvedlktretee
    qkrnrvrgilriikpcnhvlslsfpirrddgsweviegyraqhsqhrtpckggirystdv
    svdevkalaslmtykcavvdvpfggakagvkinpknytdnelekitrrftmelakkgfig
    pgvdvpapdmstgeremswiadtyastighydinahacvtgkpisqggihgrisatgrgv
    fhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgs
    iwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaasekqltksnaprv
    kakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltf
    kyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdivhsglaytmer
    sarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dhmC (C:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dhmD (D:)
    lppsvsgpvrapllrglrpaamyrclgealllsrigpaalgsvaadsavllgrargqaaa
    avaapqpglvpparrhyseaaadreddpnffkmvegffdrgasivedklvedlktretee
    qkrnrvrgilriikpcnhvlslsfpirrddgsweviegyraqhsqhrtpckggirystdv
    svdevkalaslmtykcavvdvpfggakagvkinpknytdnelekitrrftmelakkgfig
    pgvdvpapdmstgeremswiadtyastighydinahacvtgkpisqggihgrisatgrgv
    fhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgs
    iwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaasekqltksnaprv
    kakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltf
    kyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdivhsglaytmer
    sarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dhmD (D:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dhmE (E:)
    lppsvsgpvrapllrglrpaamyrclgealllsrigpaalgsvaadsavllgrargqaaa
    avaapqpglvpparrhyseaaadreddpnffkmvegffdrgasivedklvedlktretee
    qkrnrvrgilriikpcnhvlslsfpirrddgsweviegyraqhsqhrtpckggirystdv
    svdevkalaslmtykcavvdvpfggakagvkinpknytdnelekitrrftmelakkgfig
    pgvdvpapdmstgeremswiadtyastighydinahacvtgkpisqggihgrisatgrgv
    fhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgs
    iwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaasekqltksnaprv
    kakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltf
    kyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdivhsglaytmer
    sarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dhmE (E:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyne
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dhmF (F:)
    lppsvsgpvrapllrglrpaamyrclgealllsrigpaalgsvaadsavllgrargqaaa
    avaapqpglvpparrhyseaaadreddpnffkmvegffdrgasivedklvedlktretee
    qkrnrvrgilriikpcnhvlslsfpirrddgsweviegyraqhsqhrtpckggirystdv
    svdevkalaslmtykcavvdvpfggakagvkinpknytdnelekitrrftmelakkgfig
    pgvdvpapdmstgeremswiadtyastighydinahacvtgkpisqggihgrisatgrgv
    fhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgs
    iwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaasekqltksnaprv
    kakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlknlnhvsygrltf
    kyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdivhsglaytmer
    sarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dhmF (F:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft