PDB entry 6dhd

View 6dhd on RCSB PDB site
Description: Bovine glutamate dehydrogenase complexed with NADH, GTP, glutamate
Class: oxidoreductase
Keywords: glutamate, inhibitor, complex, dehydrogenase, OXIDOREDUCTASE
Deposited on 2018-05-19, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhda1, d6dhda2
  • Chain 'B':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhdb1, d6dhdb2
  • Chain 'C':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhdc1, d6dhdc2
  • Chain 'D':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhdd1, d6dhdd2
  • Chain 'E':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhde1, d6dhde2
  • Chain 'F':
    Compound: Glutamate dehydrogenase 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dhdf1, d6dhdf2
  • Heterogens: GLU, NAI, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhdA (A:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhdB (B:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhdC (C:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhdD (D:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhdE (E:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dhdF (F:)
    adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpeadkif
    lernimvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft