PDB entry 6dh0

View 6dh0 on RCSB PDB site
Description: Crystal structure of HIV-1 Protease NL4-3 I84V Mutant in complex with darunavir
Class: hydrolase/hydrolase inhibitor
Keywords: HIV, Protease, NL4-3, DRUG RESISTANCE, PROTEASE INHIBITOR, HYDROLASE INHIBITOR COMPLEX, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-05-18, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZCI0 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.07: d6dh0a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7ZCI0 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.07: d6dh0b_
  • Heterogens: 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dh0A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dh0B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvnvigrnlltqigctlnf