PDB entry 6dgs

View 6dgs on RCSB PDB site
Description: Crystal Structure of Leishmania major dihydroorotate dehydrogenase mutant Y142A
Class: oxidoreductase
Keywords: dihydroorotate dehydrogenase Leishmania major mutant Y142A, OXIDOREDUCTASE
Deposited on 2018-05-18, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Leishmania major [TaxId:5664]
    Gene: DHODH, LMJF_16_0530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QEW7 (34-End)
      • expression tag (32-33)
    Domains in SCOPe 2.07: d6dgsa1, d6dgsa2
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (fumarate)
    Species: Leishmania major [TaxId:5664]
    Gene: DHODH, LMJF_16_0530
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QEW7 (34-End)
      • expression tag (32-33)
    Domains in SCOPe 2.07: d6dgsb1, d6dgsb2
  • Heterogens: FMN, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dgsA (A:)
    mgsshhhhhhssglvpagshmasmtggqqmgrgsmslqvnllnntfanpfmnaagvmctt
    teelvamtesasgslvsksctpalregnptpryqalplgsinsmglpnngfdfylayaae
    qhdygkkplflsmsglsmrenvemckrlaavatekgvilelnlscpnvpgkpqvaadfda
    mrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkvqfitcinsignglvidae
    tesvvikpkqgfgglggryvlptalaninafyrrcpgklifgcggvytgedaflhvlaga
    smvqvgtalqeegpsiferltsellgvmakkryqtldefrgkvrtldgtaestr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgsA (A:)
    gsmslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpr
    yqalplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaava
    tekgvilelnlsdfdamrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkvqf
    itcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrrcpgklifgcg
    gvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryqtldefrgkvr
    tld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dgsB (B:)
    mgsshhhhhhssglvpagshmasmtggqqmgrgsmslqvnllnntfanpfmnaagvmctt
    teelvamtesasgslvsksctpalregnptpryqalplgsinsmglpnngfdfylayaae
    qhdygkkplflsmsglsmrenvemckrlaavatekgvilelnlscpnvpgkpqvaadfda
    mrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkvqfitcinsignglvidae
    tesvvikpkqgfgglggryvlptalaninafyrrcpgklifgcggvytgedaflhvlaga
    smvqvgtalqeegpsiferltsellgvmakkryqtldefrgkvrtldgtaestr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgsB (B:)
    gsmslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpr
    yqalplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaava
    tekgvilelnlsdfdamrqcltavsevyphsfgvkmppyfdfahfdaaaeilnefpkvqf
    itcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrrcpgklifgcg
    gvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryqtldefrgkvr
    tld