PDB entry 6dgr

View 6dgr on RCSB PDB site
Description: Crystal Structure of Human PPARgamma Ligand Binding Domain in Complex with CAY10638
Class: transcription/transcription inhibitor
Keywords: Nuclear receptors, TZDs, Drug design, Therapeutic targets, TRANSCRIPTION, TRANSCRIPTION-TRANSCRIPTION INHIBITOR complex
Deposited on 2018-05-18, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dgra_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dgrb_
  • Heterogens: GDY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dgrA (A:)
    mahhhhhhvddddkmenlyfqgqlnpesadlralakhlydsyiksfpltkakarailtgk
    ttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteya
    ksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpf
    gdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelq
    lklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgrA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
    kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
    drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
    ikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dgrB (B:)
    mahhhhhhvddddkmenlyfqgqlnpesadlralakhlydsyiksfpltkakarailtgk
    ttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteya
    ksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpf
    gdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelq
    lklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgrB (B:)
    esadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkkhikevai
    rifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgv
    lisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpg
    llnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkt
    etdhpllqeiykdl