PDB entry 6dgf

View 6dgf on RCSB PDB site
Description: Ubiquitin Variant bound to USP2
Class: protein binding
Keywords: Ubiquitin, Deubiquitinase, Ubiquitin Variant, PROTEIN BINDING
Deposited on 2018-05-17, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: USP2, UBP41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dgfa_
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (19-92)
      • expression tag (17-18)
      • engineered mutation (20)
      • engineered mutation (24)
      • engineered mutation (29-30)
    Domains in SCOPe 2.07: d6dgfb1, d6dgfb2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dgfA (A:)
    hhhhhhssglvprgssspgrdgmnsksaqglaglrnlgntcfmnsilqclsntrelrdyc
    lqrlymrdlhhgsnahtalveefakliqtiwtsspndvvspsefktqiqryaprfvgynq
    qdaqeflrflldglhnevnrvtlrpksnpenldhlpddekgrqmwrkyleredsrigdlf
    vgqlkssltctdcgycstvfdpfwdlslpiakrgypevtlmdcmrlftkedvldgdekpt
    ccrcrgrkrcikkfsiqrfpkilvlhlkrfsesrirtsklttfvnfplrdldlrefasen
    tnhavynlyavsnhsgttmgghytaycrspgtgewhtfndssvtpmsssqvrtsdayllf
    yelasppsrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgfA (A:)
    aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
    qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvdhlpdd
    ekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslpiakypevtl
    mdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfsesrirtskl
    ttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycrspgtgewhtfnd
    ssvtpmsssqvrtsdayllfyelasppsrm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dgfB (B:)
    mahhhhhhvtslykkagstmcifvctltgrcitlevepsdtienvkakiqdkegippdqq
    rlifagkqledgrtlsdyniqkestlhlvlrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgfB (B:)
    stmcifvctltgrcitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsd
    yniqkestlhlvlrlr