PDB entry 6dge

View 6dge on RCSB PDB site
Description: Crystal structure of the dimethylarginine dimethylaminohydrolase adduct with N5-(1-imino-2-chloroethyl)-L-lysine
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: enzyme adduct, hydrolase, covalent inhibitor, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2018-05-17, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDAH1, DDAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dgea_
  • Heterogens: GBG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dgeA (A:)
    mgsshhhhhhssglvprgshmasmaglghpaafgrathavvralpeslgqhalrsakgee
    vdvaraerqhqlyvgvlgsklglqvvelpadeslpdcvfvedvavvceetalitrpgaps
    rrkevdmmkealeklqlnivemkdenatldggdvlftgreffvglskrtnqrgaeiladt
    fkdyavstvpvadglhlksfcsmagpnliaigssesaqkalkimqqmsdhrydkltvpdd
    iaanciylnipnkghvllhrtpeeypesakvyeklkdhmlipvsmselekvdglltccsv
    linkkvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dgeA (A:)
    aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
    deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
    ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
    igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
    vyeklkdhmlipvsmselekvdglltccsvlinkk