PDB entry 6dg2

View 6dg2 on RCSB PDB site
Description: Antigen Binding Fragment of the Pan-ebolavirus Monoclonal Antibody 6D6
Class: immune system
Keywords: Antibody, Monoclonal, Antigen Binding Fragment, Fab, Ebola, IMMUNE SYSTEM
Deposited on 2018-05-16, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6D6 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DG2 (0-End)
  • Chain 'B':
    Compound: 6D6 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DG2
    Domains in SCOPe 2.07: d6dg2b1, d6dg2b2
  • Chain 'C':
    Compound: 6D6 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DG2 (0-End)
  • Chain 'D':
    Compound: 6D6 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DG2
    Domains in SCOPe 2.07: d6dg2d1, d6dg2d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dg2B (B:)
    divvtqshkfmstsvgdrvsitckasqdvsvavawyqqktgqspklliysasyritgvpd
    rftgsgsgtdftftissvqaedmavyycqqhystppwtfgggtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dg2B (B:)
    ivvtqshkfmstsvgdrvsitckasqdvsvavawyqqktgqspklliysasyritgvpdr
    ftgsgsgtdftftissvqaedmavyycqqhystppwtfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglrspvtksfnrg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dg2D (D:)
    divvtqshkfmstsvgdrvsitckasqdvsvavawyqqktgqspklliysasyritgvpd
    rftgsgsgtdftftissvqaedmavyycqqhystppwtfgggtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dg2D (D:)
    ivvtqshkfmstsvgdrvsitckasqdvsvavawyqqktgqspklliysasyritgvpdr
    ftgsgsgtdftftissvqaedmavyycqqhystppwtfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglrspvtksfnr