PDB entry 6dfu

View 6dfu on RCSB PDB site
Description: Tryptophan--tRNA ligase from Haemophilus influenzae.
Class: ligase
Keywords: structural genomics, IDP07216, tRNA ligase, tryptophan, Center for Structural Genomics of Infectious Diseases, CSGID, LIGASE
Deposited on 2018-05-15, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan--tRNA ligase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: trpS, HI_0637
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dfua_
  • Chain 'B':
    Compound: Tryptophan--tRNA ligase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: trpS, HI_0637
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dfub_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dfuA (A:)
    snamakpivfsgvqpsgeltignylgalrnwvkmqedyecifcvvdlhaitvrqdpvalr
    katldvlalylacgidpnkstifvqshvpehtqlswvlncytyfgemsrmtqfkdksary
    aeninvglfdypvlmaadillyqaksvpvgddqkqhleitrdianrfnalygniftipei
    figkagarimslqdpekkmsksddnrnnvvtlledpksvakkikravtdsdeppvvrydv
    qnkagvsnlldilsavtdkpiadlekefegkmyghlktavadevstllaslqerfhqyrn
    detlldnilrqgaekarakaqetlakvyeavgfvaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfuA (A:)
    kpivfsgvqpsgeltignylgalrnwvkmqedyecifcvvdlhaitvrqdpvalrkatld
    vlalylacgidpnkstifvqshvpehtqlswvlncytyfgemsrmtqfkdksaryaenin
    vglfdypvlmaadillyqaksvpvgddqkqhleitrdianrfnalygniftipeifigka
    garimslqdpekkmsksddnrnnvvtlledpksvakkikravtdsdeppvvrydvqnkag
    vsnlldilsavtdkpiadlekefegkmyghlktavadevstllaslqerfhqyrndetll
    dnilrqgaekarakaqetlakvyeavgfvaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dfuB (B:)
    snamakpivfsgvqpsgeltignylgalrnwvkmqedyecifcvvdlhaitvrqdpvalr
    katldvlalylacgidpnkstifvqshvpehtqlswvlncytyfgemsrmtqfkdksary
    aeninvglfdypvlmaadillyqaksvpvgddqkqhleitrdianrfnalygniftipei
    figkagarimslqdpekkmsksddnrnnvvtlledpksvakkikravtdsdeppvvrydv
    qnkagvsnlldilsavtdkpiadlekefegkmyghlktavadevstllaslqerfhqyrn
    detlldnilrqgaekarakaqetlakvyeavgfvaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfuB (B:)
    akpivfsgvqpsgeltignylgalrnwvkmqedyecifcvvdlhaitvrqdpvalrkatl
    dvlalylacgidpnkstifvqshvpehtqlswvlncytyfgemsrmtqfkdksaryaeni
    nvglfdypvlmaadillyqaksvpvgddqkqhleitrdianrfnalygniftipeifigg
    arimslqdpekkmsksddnrnnvvtlledpksvakkikravtdsdeppvvrydvqnkagv
    snlldilsavtdkpiadlekefegkmyghlktavadevstllaslqerfhqyrndetlld
    nilrqgaekarakaqetlakvyeavgfvaak