PDB entry 6dfs

View 6dfs on RCSB PDB site
Description: mouse TCR I.29 in complex with IAg7-p8E9E6ss
Class: immune system
Keywords: T cell receptor, type 1 diabetes, autoimmunity, IMMUNE SYSTEM
Deposited on 2018-05-15, released 2019-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mouse TCR alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFS (0-End)
    Domains in SCOPe 2.08: d6dfsa1, d6dfsa2
  • Chain 'B':
    Compound: mouse TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFS (Start-241)
    Domains in SCOPe 2.08: d6dfsb1, d6dfsb2
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, A-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Aa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04228 (0-End)
      • conflict (63)
    Domains in SCOPe 2.08: d6dfsc1, d6dfsc2
  • Chain 'D':
    Compound: H2-Ab1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q31135
      • expression tag (1-14)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dfsA (A:)
    mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
    rlivlldkkakrfslhitatqpedsaiyfcaaspsnsggsnykltfgkgtlltvtpniqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfsA (A:)
    mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
    rlivlldkkakrfslhitatqpedsaiyfcaaspsnsggsnykltfgkgtlltvtpniqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dfsB (B:)
    mtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdaevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaglgyeqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfsB (B:)
    tlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdaevksl
    pgadylatrvtdtelrlqvanmsqgrtlyctcsaglgyeqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dfsC (C:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqciaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhw
    epe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfsC (C:)
    dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
    glqciaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwglepvlkhwe
    p
    

  • Chain 'D':
    No sequence available.