PDB entry 6dfq

View 6dfq on RCSB PDB site
Description: mouse diabetogenic TCR I.29
Class: immune system
Keywords: T cell receptor, Type 1 Diabetes, Autoimmunity, IMMUNE SYSTEM
Deposited on 2018-05-15, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TcR alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFQ
    Domains in SCOPe 2.07: d6dfqa1, d6dfqa2
  • Chain 'B':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFQ (0-End)
    Domains in SCOPe 2.07: d6dfqb1, d6dfqb2
  • Chain 'C':
    Compound: TcR alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFQ (0-End)
    Domains in SCOPe 2.07: d6dfqc1, d6dfqc2
  • Chain 'D':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFQ
    Domains in SCOPe 2.07: d6dfqd1, d6dfqd2
  • Chain 'E':
    Compound: TcR alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFQ
    Domains in SCOPe 2.07: d6dfqe1, d6dfqe2
  • Chain 'F':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFQ
    Domains in SCOPe 2.07: d6dfqf1, d6dfqf2
  • Chain 'G':
    Compound: TcR alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFQ
    Domains in SCOPe 2.07: d6dfqg1, d6dfqg2
  • Chain 'H':
    Compound: TCR beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFQ
    Domains in SCOPe 2.07: d6dfqh1, d6dfqh2
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dfqA (A:)
    mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
    rlivlldkkakrfslhitatqpedsaiyfcaaspsnsggsnykltfgkgtlltvtpniqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfqA (A:)
    ekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsqr
    livlldkkakrfslhitatqpedsaiyfcaaspsgsnykltfgkgtlltvtpniqnpdpa
    vyqlrdssvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnkdfaca
    nafnnsiipedtffp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dfqB (B:)
    mtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaglgyeqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfqB (B:)
    mtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsagyeqyfgpgtrltvledlknvfppe
    vavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpaln
    dsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dfqC (C:)
    mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
    rlivlldkkakrfslhitatqpedsaiyfcaaspsnsggsnykltfgkgtlltvtpniqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfqC (C:)
    mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
    rlivlldkkakrfslhitatqpedsaiyfcaaspsykltfgkgtlltvtpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dfqD (D:)
    mtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaglgyeqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfqD (D:)
    lleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevkslp
    gadylatrvtdtelrlqvanmsqgrtlyctcsagyeqyfgpgtrltvledlknvfppeva
    vfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnds
    ryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6dfqE (E:)
    mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
    rlivlldkkakrfslhitatqpedsaiyfcaaspsnsggsnykltfgkgtlltvtpniqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfqE (E:)
    ekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsqr
    livlldkkakrfslhitatqpedsaiyfcaaspnykltfgkgtlltvtpniqnpdpavyq
    lrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdf
    acanafnnsiipedtffps
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6dfqF (F:)
    mtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaglgyeqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfqF (F:)
    lleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevkslp
    gadylatrvtdtelrlqvanmsqgrtlyctcsaggyeqyfgpgtrltvledlknvfppev
    avfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnd
    sryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6dfqG (G:)
    mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
    rlivlldkkakrfslhitatqpedsaiyfcaaspsnsggsnykltfgkgtlltvtpniqn
    pdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
    wsnksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfqG (G:)
    ekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsqr
    livlldkkakrfslhitatqpedsaiyfcaaspsnykltfgkgtlltvtpniqnpdpavy
    qlsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6dfqH (H:)
    mtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaglgyeqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfqH (H:)
    lleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevkslp
    gadylatrvtdtelrlqvanmsqgrtlyctcsayeqyfgpgtrltvledlknvfppevav
    fepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalndsr
    yclssrlrvsatfwqnprnhfrcqvqfyglsdewtqdrakpvtqivsaeawgra