PDB entry 6dfo

View 6dfo on RCSB PDB site
Description: Crystal structure of human GRP78 in complex with 8-bromoadenosine
Class: chaperone
Keywords: Endoplasmic reticulum, Unfolded protein response, Nucleoside analog, CHAPERONE
Deposited on 2018-05-15, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dfoa1, d6dfoa2
  • Chain 'B':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dfob1, d6dfob2
  • Heterogens: GBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dfoA (A:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfoA (A:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    pentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeisa
    mvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaai
    aygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfi
    klykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakf
    eelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrg
    inpdeavaygaavqagvlsg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dfoB (B:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg