PDB entry 6dfm

View 6dfm on RCSB PDB site
Description: Crystal structure of human GRP78 in complex with 8-aminoadenosine
Class: chaperone
Keywords: Endoplasmic reticulum, Unfolded protein response, Nucleoside analog, CHAPERONE
Deposited on 2018-05-15, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dfma1, d6dfma2
  • Chain 'B':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA5, GRP78
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dfmb1, d6dfmb2
  • Heterogens: 3BH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dfmA (A:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dfmB (B:)
    dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
    snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
    samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
    aiaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmeh
    fiklykkktgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltra
    kfeelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkeps
    rginpdeavaygaavqagvlsg