PDB entry 6dfl

View 6dfl on RCSB PDB site
Description: WaaP in complex with acyl carrier protein
Class: hydrolase
Keywords: Bacterial sugar kinase, HYDROLASE
Deposited on 2018-05-15, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipopolysaccharide core heptose(I) kinase RfaP
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: rfaP, waaP, PA5009
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HUF7 (1-258)
      • initiating methionine (0)
  • Chain 'B':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Gene: acpP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dflb_
  • Heterogens: G9S

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dflB (B:)
    tieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaek
    ittvqaaidyin