PDB entry 6df7

View 6df7 on RCSB PDB site
Description: TAF1-BD2 in complex with Cpd27 (6-(but-3-en-1-yl)-4-(1-methyl-6-(morpholine-4-carbonyl)-1H-benzo[d]imidazol-4-yl)-1,6-dihydro-7H-pyrrolo[2,3-c]pyridin-7-one)
Class: Transcription/Inhibitor
Keywords: TAF1-BD2, Bromodomain, small molecule inhibitor, SBDD, Transcription-Inhibitor complex
Deposited on 2018-05-14, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: TAF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription initiation factor TFIID subunit
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: TAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6df7b_
  • Heterogens: G9V, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6df7B (B:)
    mhhhhhhasdykddddkgslvprgspllddddqvafsfildnivtqkmmavpdswpfhhp
    vnkkfvpdyykvivnpmdletirkniskhkyqsresflddvnlilansvkyngpesqytk
    taqeivnvcyqtlteydehltqlekdictakeaaleeaelesldpmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6df7B (B:)
    dddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkniskh
    kyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekdict
    a