PDB entry 6df6

View 6df6 on RCSB PDB site
Description: Crystal structure of estrogen receptor alpha in complex with receptor degrader 16ab
Class: nuclear protein
Keywords: ERA, antagonist, inverse agonist, receptor, breast cancer, degrader, ligand, estrogen receptor, NUCLEAR PROTEIN
Deposited on 2018-05-14, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • conflict (98)
      • conflict (262)
    Domains in SCOPe 2.07: d6df6a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • conflict (98)
      • conflict (262)
    Domains in SCOPe 2.07: d6df6b_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • conflict (98)
      • conflict (262)
    Domains in SCOPe 2.07: d6df6c_
  • Chain 'D':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • conflict (98)
      • conflict (262)
    Domains in SCOPe 2.07: d6df6d_
  • Heterogens: G8Y, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6df6A (A:)
    mhhhhhhssgvdlgtenlyfqsnaikrskknslalsltadqmvsalldaeppilyseydp
    trpfseasmmglltnladrelvhminwakrvpgfvdltshdqvhllecawleilmiglvw
    rsmehpgkllfapnllldrnqgkcvegmveifdmllatssrfrmmnlqgeefvclksiil
    lnsgvytflsstlksleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilsh
    irhmsnkgmehlysmkcknvvpsydlllemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6df6A (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtli
    hlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmvvpsydlllemlda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6df6B (B:)
    mhhhhhhssgvdlgtenlyfqsnaikrskknslalsltadqmvsalldaeppilyseydp
    trpfseasmmglltnladrelvhminwakrvpgfvdltshdqvhllecawleilmiglvw
    rsmehpgkllfapnllldrnqgkcvegmveifdmllatssrfrmmnlqgeefvclksiil
    lnsgvytflsstlksleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilsh
    irhmsnkgmehlysmkcknvvpsydlllemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6df6B (B:)
    lalsltadqmvsalldaeppilyseypfseasmmglltnladrelvhminwakrvpgfvd
    ltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvekdhihrvldkitdtlihlmakagltlqqqh
    qrlaqlllilshirhmsnkgmehlysmkpsydlllemlda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6df6C (C:)
    mhhhhhhssgvdlgtenlyfqsnaikrskknslalsltadqmvsalldaeppilyseydp
    trpfseasmmglltnladrelvhminwakrvpgfvdltshdqvhllecawleilmiglvw
    rsmehpgkllfapnllldrnqgkcvegmveifdmllatssrfrmmnlqgeefvclksiil
    lnsgvytflsstlksleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilsh
    irhmsnkgmehlysmkcknvvpsydlllemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6df6C (C:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmvpsydlllemlda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6df6D (D:)
    mhhhhhhssgvdlgtenlyfqsnaikrskknslalsltadqmvsalldaeppilyseydp
    trpfseasmmglltnladrelvhminwakrvpgfvdltshdqvhllecawleilmiglvw
    rsmehpgkllfapnllldrnqgkcvegmveifdmllatssrfrmmnlqgeefvclksiil
    lnsgvytflsstlksleekdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilsh
    irhmsnkgmehlysmkcknvvpsydlllemldahrlhapt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6df6D (D:)
    lalsltadqmvsalldaeppilyseydptrasmmglltnladrelvhminwakrvpgfvd
    ltshdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlma
    kagltlqqqhqrlaqlllilshirhmsnkgmehlysmkvpsydlllemlda