PDB entry 6det

View 6det on RCSB PDB site
Description: The crystal structure of Tv2483 bound to L-arginine
Class: transport protein
Keywords: ABC transporter, amino-acid-binding protein, ligand-binding protein, TRANSPORT PROTEIN
Deposited on 2018-05-13, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tv2483
    Species: Treponema vincentii [TaxId:69710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6deta_
  • Heterogens: ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6detA (A:)
    mgsdkihhhhhhenlyfqgkveyiedpswskvqvksalvigvsdfvpilsfrnekneivg
    ydidiftelcrrlgihpifypiqwaqkeillntgvidciasgfsvteerkqhyrmctpyl
    qnakivvtlagrgyqtlaqlqnrtiaveadtagdeallnvealkdhviikamatidqlye
    aldsgtcdaivvdliysldtldknpqysiineaisteyytfafrqadaslvakiesvlae
    mnedetipnfsrkwfgsnlsilnvrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6detA (A:)
    iedpswskvqvksalvigvsdfvpilsfrnekneivgydidiftelcrrlgihpifypiq
    waqkeillntgvidciasgfsvteerkqhyrmctpylqnakivvtlagrgyqtlaqlqnr
    tiaveadtagdeallnvealkdhviikamatidqlyealdsgtcdaivvdliysldtldk
    npqysiineaisteyytfafrqadaslvakiesvlaemnedetipnfsrkwfgsnlsiln
    vrf