PDB entry 6dej

View 6dej on RCSB PDB site
Description: The structure of HcRed7, a brighter and red-shifted HcRed variant
Class: fluorescent protein
Keywords: HcRed, red, far-red, FLUORESCENT PROTEIN
Deposited on 2018-05-12, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like non-fluorescent chromoprotein
    Species: Heteractis crispa [TaxId:175771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95W85 (Start-234)
      • engineered mutation (45)
      • chromophore (72)
      • engineered mutation (74)
      • engineered mutation (129)
      • engineered mutation (150)
      • engineered mutation (175)
      • engineered mutation (180)
      • engineered mutation (203)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d6deja_
  • Chain 'B':
    Compound: GFP-like non-fluorescent chromoprotein
    Species: Heteractis crispa [TaxId:175771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95W85 (10-End)
      • engineered mutation (45)
      • chromophore (72)
      • engineered mutation (74)
      • engineered mutation (129)
      • engineered mutation (150)
      • engineered mutation (175)
      • engineered mutation (180)
      • engineered mutation (203)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d6dejb_
  • Chain 'C':
    Compound: GFP-like non-fluorescent chromoprotein
    Species: Heteractis crispa [TaxId:175771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95W85 (10-End)
      • engineered mutation (45)
      • chromophore (72)
      • engineered mutation (74)
      • engineered mutation (129)
      • engineered mutation (150)
      • engineered mutation (175)
      • engineered mutation (180)
      • engineered mutation (203)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d6dejc_
  • Chain 'D':
    Compound: GFP-like non-fluorescent chromoprotein
    Species: Heteractis crispa [TaxId:175771]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95W85 (Start-234)
      • engineered mutation (45)
      • chromophore (72)
      • engineered mutation (74)
      • engineered mutation (129)
      • engineered mutation (150)
      • engineered mutation (175)
      • engineered mutation (180)
      • engineered mutation (203)
      • engineered mutation (208)
    Domains in SCOPe 2.07: d6dejd_
  • Heterogens: SO4, 12P, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dejA (A:)
    mhhhhhhgsgmagllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegap
    lpfafdilapccesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtsleg
    ncliykvkvhgtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlich
    hytsyrskkavraltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpekan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dejA (A:)
    agllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapc
    cesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhg
    tnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkav
    raltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpekan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dejB (B:)
    mhhhhhhgsgmagllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegap
    lpfafdilapccesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtsleg
    ncliykvkvhgtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlich
    hytsyrskkavraltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpekan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dejB (B:)
    magllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilap
    ccesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvh
    gtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskka
    vraltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpeka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dejC (C:)
    mhhhhhhgsgmagllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegap
    lpfafdilapccesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtsleg
    ncliykvkvhgtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlich
    hytsyrskkavraltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpekan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dejC (C:)
    magllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilap
    ccesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvh
    gtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskka
    vraltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpeka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dejD (D:)
    mhhhhhhgsgmagllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegap
    lpfafdilapccesktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtsleg
    ncliykvkvhgtnfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlich
    hytsyrskkavraltmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpekan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dejD (D:)
    gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc
    esktfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhgt
    nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkavr
    altmpgfhftdyrlqmlrkkkdeyfelyeasvarysdlpekan