PDB entry 6deg

View 6deg on RCSB PDB site
Description: Crystal structure of a DNA polymerase III subunit beta DnaN sliding clamp from Bartonella birtlesii LL-WM9
Class: DNA binding protein
Keywords: NIAID, National Institute of Allergy and Infectious Diseases, griselimycin, antibiotic, DNA polymerase, DnaN, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, DNA BINDING PROTEIN
Deposited on 2018-05-11, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta sliding clamp
    Species: Bartonella birtlesii LL-WM9 [TaxId:1094552]
    Gene: ME7_01154
    Database cross-references and differences (RAF-indexed):
    • Uniprot J1IY24 (8-380)
      • expression tag (7)
    Domains in SCOPe 2.07: d6dega1, d6dega2, d6dega3, d6dega4
  • Chain 'B':
    Compound: Beta sliding clamp
    Species: Bartonella birtlesii LL-WM9 [TaxId:1094552]
    Gene: ME7_01154
    Database cross-references and differences (RAF-indexed):
    • Uniprot J1IY24 (8-380)
      • expression tag (7)
    Domains in SCOPe 2.07: d6degb1, d6degb2, d6degb3, d6degb4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6degA (A:)
    mahhhhhhmritvdrsqffkslgrvhrvverrntvpilsnvlidaengsvqlkatdldle
    vtesftvniekagaitvpayllydivrklpdgseivlsvdenqasamsivsgcthfqlqc
    lpkidfpeslpgqfgcrfflsasklkhlldctqfaisteetryylngiyfhivhddvlkl
    rlvatdghrlaqvdmeapsgvdgmpgviiprkavgelqkllseeidgdvcielsetkirf
    slgsvvftsklvdgtfpdyqrviplgndrklivnrqdfssavdrvstisndrgravklti
    ehgqlklvvnnpdsgsaedqlaatytsepleigfnsrylldiagqlssdemvfmlsdava
    palirdnnnaevlyvlmpvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6degA (A:)
    hmritvdrsqffkslgrvhrvvpilsnvlidaengsvqlkatdldlevtesftvniekag
    aitvpayllydivrklpdgseivlsvdsamsivsgcthfqlqclpkidfpqfgcrfflsa
    sklkhlldctqfangiyfhivhddvlklrlvatdghrlaqvdmeapsgvdgmpgviiprk
    avgelqkllseeidgdvcielsetkirfslgsvvftsklvdgtfpdyqrviplgndrkli
    vnrqdfssavdrvstisndrgravkltiehgqlklvvnnpdsgsaedqlaatytseplei
    gfnsrylldiagqlssdemvfmlsdavapalirdnnnaevlyvlmpvrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6degB (B:)
    mahhhhhhmritvdrsqffkslgrvhrvverrntvpilsnvlidaengsvqlkatdldle
    vtesftvniekagaitvpayllydivrklpdgseivlsvdenqasamsivsgcthfqlqc
    lpkidfpeslpgqfgcrfflsasklkhlldctqfaisteetryylngiyfhivhddvlkl
    rlvatdghrlaqvdmeapsgvdgmpgviiprkavgelqkllseeidgdvcielsetkirf
    slgsvvftsklvdgtfpdyqrviplgndrklivnrqdfssavdrvstisndrgravklti
    ehgqlklvvnnpdsgsaedqlaatytsepleigfnsrylldiagqlssdemvfmlsdava
    palirdnnnaevlyvlmpvrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6degB (B:)
    hmritvdrsqffkslgrvhrvverrntvpilsnvlidaengsvqlkatdldlevtesftv
    niekagaitvpayllydivrklpdgseivlsvdasamsivsgcthfqlqclpkidfpeqf
    gcrfflsasklkhlldctqfangiyfhivhddvlklrlvatdghrlaqvdmeapsgvdgm
    pgviiprkavgelqkllseeidgdvcielsetkirfslgsvvftsklvdgtfpdyqrvip
    lgndrklivnrqdfssavdrvstiravkltiehgqlklvvnnpdsgsaedqlaatytsep
    leigfnsrylldiagqlssdemvfmlsdavapalirdnnaevlyvlmpvrv