PDB entry 6de9

View 6de9 on RCSB PDB site
Description: mitoNEET bound to furosemide
Class: metal binding protein
Keywords: mitoNEET, FES, furosemide, METAL BINDING PROTEIN
Deposited on 2018-05-11, released 2019-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CDGSH iron-sulfur domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CISD1, C10orf70, ZCD1, MDS029
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ45 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d6de9a1, d6de9a2
  • Heterogens: FUN, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6de9A (A:)
    tkrfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkh
    neetgdnvgpliikkket
    

    Sequence, based on observed residues (ATOM records): (download)
    >6de9A (A:)
    tkrfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkh
    neetgdnvgpliikk