PDB entry 6de8

View 6de8 on RCSB PDB site
Description: Crystal Structure of Bifunctional Enzyme FolD-Methylenetetrahydrofolate Dehydrogenase/Cyclohydrolase from Campylobacter jejuni
Class: oxidoreductase
Keywords: MTHFDC, alpha-beta-fold, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2018-05-11, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein folD
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: folD, Cj0855
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PA35 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6de8a1, d6de8a2, d6de8a3
  • Chain 'B':
    Compound: Bifunctional protein folD
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: folD, Cj0855
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PA35 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6de8b1, d6de8b2, d6de8b3
  • Heterogens: IOD, GOL, CL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6de8A (A:)
    snamtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakacee
    cgikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdv
    dgfhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatml
    lnagatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgk
    ivgdvdfeevskkssyitpvpggvgpmtiamllentvksaknrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >6de8A (A:)
    amtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakaceecg
    ikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdvdg
    fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln
    agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv
    gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6de8B (B:)
    snamtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakacee
    cgikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdv
    dgfhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatml
    lnagatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgk
    ivgdvdfeevskkssyitpvpggvgpmtiamllentvksaknrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >6de8B (B:)
    amtlldgkalsakikeelkeknqflkskgiesclavilvgdnpasqtyvkskakaceecg
    ikslvyhlnenitqnellalintlnhddsvhgilvqlplpdhickdlilesiisskdvdg
    fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln
    agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv
    gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrl