PDB entry 6ddw

View 6ddw on RCSB PDB site
Description: Mycobacterium tuberculosis Dihydrofolate Reductase complexed with beta-NADPH and N-(4-{[(2-amino-4-oxo-3,4-dihydropteridin-6-yl)methyl]amino}-2-hydroxybenzene-1-carbonyl)-L-glutamic acid
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: DHFR, Antifolate, oxidoreductase-oxidoreductase inhibitor complex
Deposited on 2018-05-10, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: folA, dfrA, Rv2763c, MTV002.28c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ddwa_
  • Heterogens: NDP, G7D, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ddwA (A:)
    mtmvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplp
    grrnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdig
    lpreagdalapvldetwrgetgewrfsrsglryrlysyhrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ddwA (A:)
    mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
    rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
    reagdalapvldetwrgetgewrfsrsglryrlysyhrs