PDB entry 6ddr

View 6ddr on RCSB PDB site
Description: Crystal Structure Analysis of the Epitope of an Anti-MICA Antibody
Class: immune system
Keywords: Fab fragment-antigen complex, immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2018-05-10, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-MICA Fab fragment light chain clone 13A9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DDR (0-213)
    Domains in SCOPe 2.07: d6ddra1, d6ddra2
  • Chain 'B':
    Compound: Anti-MICA Fab fragment heavy chain clone 13A9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DDR (0-220)
  • Chain 'C':
    Compound: MHC class I polypeptide-related sequence A
    Species: Homo sapiens [TaxId:9606]
    Gene: MICA, hCG_2001511
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ddrA (A:)
    diqmtqspaslsasvgetvtitcrasgnihsylawyqqkqgkspqllvyyaetladgvps
    rfsgrgsgtqyslkinslqpedfgsyfcqqfwttpytfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.