PDB entry 6ddp

View 6ddp on RCSB PDB site
Description: Mycobacterium tuberculosis Dihydrofolate Reductase complexed with beta-NADPH and 3'-[(2R)-4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl]-5'-methoxy[1,1'-biphenyl]-4-carboxylic acid
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: DHFR, antifolate, oxidoreductase-oxidoreductase inhibitor complex
Deposited on 2018-05-10, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: folA, dfrA, Rv2763c, MTV002.28c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ddpa_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: folA, dfrA, Rv2763c, MTV002.28c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ddpb_
  • Chain 'C':
    Compound: dihydrofolate reductase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: folA, dfrA, Rv2763c, MTV002.28c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ddpc_
  • Chain 'D':
    Compound: dihydrofolate reductase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: folA, dfrA, Rv2763c, MTV002.28c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ddpd_
  • Heterogens: NDP, G6Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ddpA (A:)
    mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
    rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
    reagdalapvldetwrgetgewrfsrsglryrlysyhrs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ddpB (B:)
    mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
    rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
    reagdalapvldetwrgetgewrfsrsglryrlysyhrs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ddpC (C:)
    mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
    rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
    reagdalapvldetwrgetgewrfsrsglryrlysyhrs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ddpD (D:)
    mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
    rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
    reagdalapvldetwrgetgewrfsrsglryrlysyhrs