PDB entry 6ddm

View 6ddm on RCSB PDB site
Description: Crystal Structure Analysis of the Epitope of an Anti-MICA Antibody
Class: immune system
Keywords: Fab fragment-antigen complex, immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2018-05-10, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-MICA Fab fragment light chain clone 1D5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DDM (0-214)
    Domains in SCOPe 2.07: d6ddma1, d6ddma2
  • Chain 'B':
    Compound: Anti-MICA Fab fragment heavy chain clone 1D5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DDM (Start-219)
  • Chain 'C':
    Compound: MHC class I polypeptide-related sequence A
    Species: Homo sapiens [TaxId:9606]
    Gene: MICA, hCG_2001511
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ddmA (A:)
    eiiltqspttmaaspgekititcsasssisshylhwyqqksgfspklliyrtsnlasgvp
    arfsgsgsgtsysltigtmeaedvatyycqqgsslpltfgagtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.