PDB entry 6ddj

View 6ddj on RCSB PDB site
Description: Crystal Structure of the human BRD2 BD2 bromodimain in complex with a Tetrahydroquinoline analogue
Class: Transcription/Inhibitor
Keywords: BET, BRD2, bromodomain, Inhibitor, Complex, Transcription, Transcription-Inhibitor complex
Deposited on 2018-05-10, released 2019-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-25, with a file datestamp of 2020-11-20.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD2, KIAA9001, RING3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25440 (7-114)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d6ddja1, d6ddja2
• Heterogens: G7V, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ddjA (A:)
  gshmqdpeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvk
  rkmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd