PDB entry 6ddi

View 6ddi on RCSB PDB site
Description: Crystal Structure of the human BRD2 BD1 bromodomain in complex with a Tetrahydroquinoline analogue
Class: Transcription/Inhibitor
Keywords: BET, BRD2, bromodomain, Inhibitor, Complex, Transcription, Transcription-Inhibitor complex
Deposited on 2018-05-10, released 2019-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ddia_
  • Chain 'B':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ddib_
  • Chain 'C':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ddic_
  • Heterogens: G7V, SO4, EDO, 03S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ddiA (A:)
    gshmsnpkkpgrvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmd
    mgtikrrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq
    eeqelvvtipknshkkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ddiA (A:)
    grvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlen
    nyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ddiB (B:)
    gshmsnpkkpgrvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmd
    mgtikrrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq
    eeqelvvtipknshkkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ddiB (B:)
    tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
    waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ddiC (C:)
    gshmsnpkkpgrvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmd
    mgtikrrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq
    eeqelvvtipknshkkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ddiC (C:)
    tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
    waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq