PDB entry 6ddb

View 6ddb on RCSB PDB site
Description: Crystal structure of the double mutant (D52N/R367Q) of NT5C2-537X in the basal state, Northeast Structural Genomics Consortium Target
Class: hydrolase
Keywords: Structural Genomics, PSI-Biology, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2018-05-09, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosolic purine 5'-nucleotidase
    Species: Homo sapiens [TaxId:9606]
    Gene: NT5C2, NT5B, NT5CP, PNT5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49902
      • engineered mutation (69)
      • engineered mutation (384)
    Domains in SCOPe 2.07: d6ddba_
  • Chain 'B':
    Compound: cytosolic purine 5'-nucleotidase
    Species: Homo sapiens [TaxId:9606]
    Gene: NT5C2, NT5B, NT5CP, PNT5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49902
      • engineered mutation (69)
      • engineered mutation (384)
    Domains in SCOPe 2.07: d6ddbb_
  • Heterogens: MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ddbA (A:)
    gsshhhhhhssglvprgsmstswsdrlqnaadmpanmdkhalkkyrreayhrvfvnrsla
    mekikcfgfnmdytlavykspeyeslgfeltverlvsigypqellsfaydstfptrglvf
    dtlygnllkvdaygnllvcahgfnfirgpetreqypnkfiqrddterfyilntlfnlpet
    yllaclvdfftncprytscetgfkdgdlfmsyrsmfqdvrdavdwvhykgslkektvenl
    ekyvvkdgklplllsrmkevgkvflatnsdykytdkimtylfdfphgpkpgsshrpwqsy
    fdlilvdarkplffgegtvlrqvdtktgklkigtytgplqhgivysggssdticdllgak
    gkdilyigdhifgdilkskkrqgwqtflvipelaqelhvwtdksslfeelqsldiflael
    ykhldsssnerpdissiqrrikkvthdmdmcygmmgslfrsgsrqtlfasqvmryadlya
    asfinllyypfsylfraahvlmphestvehthvdinemesplatrnrtsvdfkdtdykrh
    qltrsiseikppnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ddbA (A:)
    kyrreayhrvfvnrslamekikcfgfnmdytlavykspeyeslgfeltverlvsigypqe
    llsfaydstfptrglvfdtlygnllkvdaygnllvcahgfnfirgpetreqypnkfiqrd
    dterfyilntlfnlpetyllaclvdfftncprytscetgfkdgdlfmsyrsmfqdvrdav
    dwvhykgslkektvenlekyvvkdgklplllsrmkevgkvflatnsdykytdkimtylfd
    fphgpkpgsshrpwqsyfdlilvdarkplffgegtvlrqvdtktgklkigtytgplqhgi
    vysggssdticdllgakgkdilyigdhifgdilkskkrqgwqtflvipelaqelhvwtdk
    sslfeelqsldiflaelykhldsssnerpdissiqrrikkvthdmdmcygmmgslfrsgs
    rqtlfasqvmryadlyaasfinllyypfsylfraahvlmphestveh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ddbB (B:)
    gsshhhhhhssglvprgsmstswsdrlqnaadmpanmdkhalkkyrreayhrvfvnrsla
    mekikcfgfnmdytlavykspeyeslgfeltverlvsigypqellsfaydstfptrglvf
    dtlygnllkvdaygnllvcahgfnfirgpetreqypnkfiqrddterfyilntlfnlpet
    yllaclvdfftncprytscetgfkdgdlfmsyrsmfqdvrdavdwvhykgslkektvenl
    ekyvvkdgklplllsrmkevgkvflatnsdykytdkimtylfdfphgpkpgsshrpwqsy
    fdlilvdarkplffgegtvlrqvdtktgklkigtytgplqhgivysggssdticdllgak
    gkdilyigdhifgdilkskkrqgwqtflvipelaqelhvwtdksslfeelqsldiflael
    ykhldsssnerpdissiqrrikkvthdmdmcygmmgslfrsgsrqtlfasqvmryadlya
    asfinllyypfsylfraahvlmphestvehthvdinemesplatrnrtsvdfkdtdykrh
    qltrsiseikppnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ddbB (B:)
    kyrreayhrvfvnrslamekikcfgfnmdytlavykspeyeslgfeltverlvsigypqe
    llsfaydstfptrglvfdtlygnllkvdaygnllvcahgfnfirgpetreqypnkfiqrd
    dterfyilntlfnlpetyllaclvdfftncprytscetgfkdgdlfmsyrsmfqdvrdav
    dwvhykgslkektvenlekyvvkdgklplllsrmkevgkvflatnsdykytdkimtylfd
    fphgpkpgsshrpwqsyfdlilvdarkplffgegtvlrqvdtktgklkigtytgplqhgi
    vysggssdticdllgakgkdilyigdhifgdilkskkrqgwqtflvipelaqelhvwtdk
    sslfeelqsldiflaelykhldsssnerpdissiqrrikkvthdmdmcygmmgslfrsgs
    rqtlfasqvmryadlyaasfinllyypfsylfraahvlmphestveh