PDB entry 6dd0

View 6dd0 on RCSB PDB site
Description: Crystal structure of VIM-2 complexed with compound 8
Class: hydrolase
Keywords: beta-lactamase, carbapenemase, phosphonate, inhibitor, HYDROLASE
Deposited on 2018-05-08, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase class b vim-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, VIM-2, vim-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dd0a_
  • Chain 'B':
    Compound: beta-lactamase class b vim-2
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, VIM-2, vim-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dd0b_
  • Heterogens: P9T, ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dd0A (A:)
    gpvdssgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllid
    tawgakntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlae
    vegneipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyels
    rtsagnvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsv
    ve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dd0A (A:)
    eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
    taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
    thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
    adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dd0B (B:)
    gpvdssgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllid
    tawgakntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlae
    vegneipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyels
    rtsagnvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsv
    ve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dd0B (B:)
    eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
    taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
    thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
    adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn