PDB entry 6dcz

View 6dcz on RCSB PDB site
Description: The N-terminal domain of PA endonuclease from the influenza H1N1 virus in complex with 3-hydroxy-4-oxo-4H-pyran-2-carboxylic acid
Class: hydrolase/hydrolase inhibitor
Keywords: Inhibitor, Endonuclease, Influenza, PA domain, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2018-05-08, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: Influenza A virus [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (6-End)
      • expression tag (5)
      • conflict (57)
    Domains in SCOPe 2.07: d6dcza1, d6dcza2
  • Heterogens: G5Y, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dczA (A:)
    mgsgmamedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfgsg
    dpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrre
    vhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirqemasrs
    lwdsfrqserge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dczA (A:)
    amedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfgallkhrf
    eiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekan
    kiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqser