PDB entry 6dcu

View 6dcu on RCSB PDB site
Description: Crystal structure of PPAR gamma co-crystallized with nTZDpa
Class: dna binding protein/agonist
Keywords: Nuclear receptor, Transcription factor, Super agonist, Ligand binding domain, Coactivator, MED1, DNA BINDING PROTEIN, dna binding protein-AGONIST complex
Deposited on 2018-05-08, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dcua_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dcub_
  • Heterogens: NZA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dcuA (A:)
    mahhhhhhvddddkmenlyfqgqlnpesadlralakhlydsyiksfpltkakarailtgk
    ttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteya
    ksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpf
    gdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelq
    lklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdlylvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dcuA (A:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkiqsk
    evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
    kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
    drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
    ikktetdmslhpll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dcuB (B:)
    mahhhhhhvddddkmenlyfqgqlnpesadlralakhlydsyiksfpltkakarailtgk
    ttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteya
    ksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpf
    gdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelq
    lklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdlylvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dcuB (B:)
    pesadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkievairif
    qgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlis
    egqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpglln
    vkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetd
    mslhpll