PDB entry 6dcq

View 6dcq on RCSB PDB site
Description: Ectodomain of full length, wild type HIV-1 glycoprotein clone PC64M18C043 in complex with PGT151 Fab
Class: viral protein
Keywords: HIV-1, Glycoprotein, Env, VIRAL PROTEIN
Deposited on 2018-05-08, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Immunoglobulin G PGT151 Fab, Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCQ (Start-131)
    • Uniprot S6B291 (132-End)
  • Chain 'L':
    Compound: Immunoglobulin G PGT151 Fab, Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCQ (0-End)
    • Uniprot Q8TCD0
    Domains in SCOPe 2.07: d6dcql_
  • Chain 'M':
    Compound: Immunoglobulin G PGT151 Fab, Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCQ (Start-131)
    • Uniprot S6B291 (132-End)
  • Chain 'N':
    Compound: Immunoglobulin G PGT151 Fab, Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCQ (Start-110)
    • Uniprot Q8TCD0 (111-End)
    Domains in SCOPe 2.07: d6dcqn_
  • Heterogens: NAG, FUC, MAN, BMA, GAL

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6dcqL (L:)
    divmtqtplslsvtpgqpasiscksseslrqsngktslywyrqkpgqspqllvfevsnrf
    sgvsdrfvgsgsgtdftlrisrveaedvgfyycmqskdfpltfgggtkvdlkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dcqL (L:)
    divmtqtplslsvtpgqpasiscksseslrqsngktslywyrqkpgqspqllvfevsnrf
    sgvsdrfvgsgsgtdftlrisrveaedvgfyycmqskdfpltfgggtkvd
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6dcqN (N:)
    divmtqtplslsvtpgqpasiscksseslrqsngktslywyrqkpgqspqllvfevsnrf
    sgvsdrfvgsgsgtdftlrisrveaedvgfyycmqskdfpltfgggtkvdlkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dcqN (N:)
    ivmtqtplslsvtpgqpasiscksseslrqsngktslywyrqkpgqspqllvfevsnrfs
    gvsdrfvgsgsgtdftlrisrveaedvgfyycmqskdfpltfgggtkvdlkr