PDB entry 6dcm

View 6dcm on RCSB PDB site
Description: The atomic resolution crystal structure of Kringle 2 variant bound with EACA
Class: blood clotting
Keywords: Kringle 2, Blood clotting
Deposited on 2018-05-07, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Gene: PLG
    Database cross-references and differences (RAF-indexed):
    • PDB 6DCM (0-84)
    Domains in SCOPe 2.07: d6dcma_
  • Heterogens: ACA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dcmA (A:)
    efseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdn
    dpqgpwcfttdpnkrweycdiprca