PDB entry 6dcg

View 6dcg on RCSB PDB site
Description: Discovery of MK-8353: An Orally Bioavailable Dual Mechanism ERK Inhibitor for Oncology
Class: transferase/transferase inhibitor
Keywords: kinase inhibitor, kinase selectivity, transferase, serine/ threonine-protein kinase, map kinase, transferase-transferase inhibitor complex
Deposited on 2018-05-06, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Mapk1, Erk2, Mapk, Prkm1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dcga_
  • Heterogens: G67, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dcgA (A:)
    mahhhhhhmaaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaik
    kispfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlyk
    llktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarva
    dpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyl
    dqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkml
    tfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarf
    qpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dcgA (A:)
    vfdvgprytnlsyigegaygmvcsaydrvaikkispfehqtycqrtlreikillrfrhen
    iigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyqilrglkyihs
    anvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyrapeimlns
    kgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarn
    yllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyydpsde
    piaeapflpkeklkelifeetarfqp