PDB entry 6dcd

View 6dcd on RCSB PDB site
Description: Mycobacterium marinum cytochrome P450 CYP150A6 in the substrate-free form
Class: oxidoreductase
Keywords: cytochrome P450, monooxygenase, heme protein, OXIDOREDUCTASE
Deposited on 2018-05-05, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 150A6 Cyp150A6
    Species: Mycobacterium marinum [TaxId:216594]
    Gene: cyp150A6, MMAR_4694
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dcda_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dcdA (A:)
    mssyesidfftdpslipdphpyfdylrsqspvlrlpqygvvavtgyeeatavykdtdsfs
    ncvalggpfpplpfapngddvnaqidahreqfpmyehmvtmdppehsrarsilsrlltps
    rlkqneefmwrladrqldeflgagecefiseyakpfatlviadllgvpeddrkdfrvvlg
    adrmgrvgaldhesvgvnplqwlddkfsayiedrrrqprndvltalatatypdgstpevi
    dvvrsatflfaagqettaklltaamrvlgdrpdiqrrlrenrslipnfieeslrmdspvk
    sdsrlarkrttvggldiaagtvvmvlpgaanrdprrfedphefrldrpnvrehmafargv
    hscpggplarvegrvslerildrmldiainedrhgpaddrrytyeptyilrgltelhitf
    tpag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dcdA (A:)
    syesidfftdpslipdphpyfdylrsqspvlrlpqygvvavtgyeeatavykdtdsfsnc
    valggpfpplpfapngddvnaqidahreqfpmyehmvtmdppehsrarsilsrlltpsrl
    kqneefmwrladrqldeflgagecefiseyakpfatlviadllgvpeddrkdfrvvlgvn
    plqwlddkfsayiedrrrqprndvltalatatypdgstpevidvvrsatflfaagqetta
    klltaamrvlgdrpdiqrrlrenrslipnfieeslrmdspvksdsrlarkrttvggldia
    agtvvmvlpgaanrdprrfedphefrldrpnvrehmafargvhscpggplarvegrvsle
    rildrmldiainedrhgpaddrrytyeptyilrgltelhitftpag