PDB entry 6dc4

View 6dc4 on RCSB PDB site
Description: RSV-neutralizing human antibody AM22
Class: immune system
Keywords: Antibody, Fab, IMMUNE SYSTEM
Deposited on 2018-05-04, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab AM22 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DC4 (0-103)
    • Uniprot Q6GMX6 (111-227)
  • Chain 'L':
    Compound: Fab AM22 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DC4 (0-106)
    • Uniprot Q8TCD0 (107-214)
    Domains in SCOPe 2.07: d6dc4l1, d6dc4l2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dc4L (L:)
    eivltqspgtlslspgeratlscrasqivsrnhlawyqqkpgqaprllifgassratgip
    vrfsgsgsgtdftltinglapedfavyyclssdssiftfgpgtkvdfkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec