PDB entry 6dbn

View 6dbn on RCSB PDB site
Description: Jak1 with compound 23
Class: transferase
Keywords: kinase, TRANSFERASE
Deposited on 2018-05-03, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK1, JAK1A, JAK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dbna_
  • Heterogens: G4J, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dbnA (A:)
    gsimrdinkleeqnpdivsekkpatevdpthfekrflkrirdlgeghfgkvelcrydpeg
    dntgeqvavkslkpesggnhiadlkkeieilrnlyhenivkykgictedggngiklimef
    lpsgslkeylpknknkinlkqqlkyavqickgmdylgsrqyvhrdlaarnvlvesehqvk
    igdfgltkaietdkeyytvkddrdspvfwyapeclmqskfyiasdvwsfgvtlhelltyc
    dsdsspmalflkmigpthgqmtvtrlvntlkegkrlpcppncpdevyqlmrkcwefqpsn
    rtsfqnliegfeallk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbnA (A:)
    pthfekrflkrirdlgeghfgkvelcrydpegdntgeqvavkslkpnhiadlkkeieilr
    nlyhenivkykgictengiklimeflpsgslkeylpknknkinlkqqlkyavqickgmdy
    lgsrqyvhrdlaarnvlvesehqvkigdfgltkaietdkeyytvkddrdspvfwyapecl
    mqskfyiasdvwsfgvtlhelltycdsdsspmalflkmigpthgqmtvtrlvntlkegkr
    lpcppncpdevyqlmrkcwefqpsnrtsfqnliegfeallk