PDB entry 6dbk

View 6dbk on RCSB PDB site
Description: Tyk2 with compound 8
Class: transferase
Keywords: kinase, TRANSFERASE
Deposited on 2018-05-03, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-receptor tyrosine-protein kinase TYK2
    Species: Homo sapiens [TaxId:9606]
    Gene: TYK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29597
      • engineered mutation (71)
      • engineered mutation (104)
      • engineered mutation (106-107)
      • conflict (151)
      • engineered mutation (277)
    Domains in SCOPe 2.07: d6dbka_
  • Heterogens: G5D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dbkA (A:)
    mahhhhhhhhhhgalevlfqgpgdptvfhkrylkkirdlgeghfgkvslycydptndgtg
    emvavkalkadagpqhrsgwkqeidilrtlyhehiikykgccedagaaslqlvmeyvplg
    slrdylprhsiglaqlllfaqqicegmaylhsqhyihrdlaarnvlldndrlvkigdfgl
    akavpegheyyrvredgdspvfwyapeclkeykfyyasdvwsfgvtlyellthcdssqsp
    ptkfleligiaqgqmtvlrltellergerlprpdkcpaevyhlmkncweteasfrptfen
    lipilktvhekyqgqaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbkA (A:)
    ptvfhkrylkkirdlgeghfgkvslycydptndgtgemvavkalkadagpqhrsgwkqei
    dilrtlyhehiikykgccedagaaslqlvmeyvplgslrdylprhsiglaqlllfaqqic
    egmaylhsqhyihrdlaarnvlldndrlvkigdfglakavpegheyyrvredgdspvfwy
    apeclkeykfyyasdvwsfgvtlyellthcdssqspptkfleligiaqgqmtvlrltell
    ergerlprpdkcpaevyhlmkncweteasfrptfenlipilktvhekyqg