PDB entry 6dbh

View 6dbh on RCSB PDB site
Description: Crystal structure of PPAR gamma in complex with NMP422
Class: DNA binding protein/agonist
Keywords: Nuclear receptor, Transcription factor, Super agonist, Ligand binding domain, Coactivator, MED1, DNA BINDING PROTEIN, dna binding protein-AGONIST complex
Deposited on 2018-05-03, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dbha_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dbhb_
  • Heterogens: G3S, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dbhA (A:)
    mahhhhhhvddddkmenlyfqgqlnpesadlralakhlydsyiksfpltkakarailtgk
    ttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteya
    ksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpf
    gdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelq
    lklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbhA (A:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikf
    khitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhe
    iiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdl
    aifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrq
    ivtehvqllqvikktetdmslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dbhB (B:)
    mahhhhhhvddddkmenlyfqgqlnpesadlralakhlydsyiksfpltkakarailtgk
    ttdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteya
    ksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpf
    gdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelq
    lklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbhB (B:)
    esadlralakhlydsyiksfpltkakarailtgktdkspfviydmnslmmgedkikfkhi
    tpkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlas
    lmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavii
    lsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvql
    lqvikktetlhpllqeiyk