PDB entry 6dbf

View 6dbf on RCSB PDB site
Description: Crystal Structure of VHH R303 in complex with InlB-LRR
Class: immune system
Keywords: nanobody VHH Listeria Internalin, IMMUNE SYSTEM
Deposited on 2018-05-03, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Listeria virulence factor InlB
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45GD4 (16-End)
      • conflict (97)
      • conflict (222)
    Domains in SCOPe 2.07: d6dbfa_
  • Chain 'B':
    Compound: InlB specific VHH R303
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBF (0-End)
    Domains in SCOPe 2.07: d6dbfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dbfA (A:)
    mgshhhhhhenlyfqgetitvstpikqifpddafaetikdnlkkksvtdavtqnelnsid
    qiiannsdiksvqgiqylpnvtklflngnkltdikplvnlknlgwlfldenkikdlsslk
    dlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqis
    divplagltklqnlylsknhisdlralaglknldvlelfsqealnkpin
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbfA (A:)
    etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikplvnlknlgwlfldenkikdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqeal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dbfB (B:)
    qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
    adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
    vssgseqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbfB (B:)
    qvkleesgggsvqaggslrlscaasghtystycmgwfrqvkeregvarinvggsstwyad
    svrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvtvs
    s