PDB entry 6dbe

View 6dbe on RCSB PDB site
Description: Crystal Structure of VHH R330
Class: immune system
Keywords: nanobody VHH Listeria, IMMUNE SYSTEM
Deposited on 2018-05-03, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nanobody VHH R303
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBE
    Domains in SCOPe 2.07: d6dbea_
  • Chain 'B':
    Compound: nanobody VHH R303
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBE
    Domains in SCOPe 2.07: d6dbeb_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dbeA (A:)
    qvkleesggglvqaggslrlscaasgstfsiytmgwfrqapgkerefvadiswnggstyy
    adsvkgrftiyrdnykntvylqmnslkpedtavyycnaddlmidrdywgqgtqvtvssgs
    eqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbeA (A:)
    vkleesggglvqaggslrlscaasgtfsiytmgwfrqapgkerefvadiswnggstyyad
    svkgrftiyrdnykntvylqmnslkpedtavyycnaddlmidrdywgqgtqvtvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dbeB (B:)
    qvkleesggglvqaggslrlscaasgstfsiytmgwfrqapgkerefvadiswnggstyy
    adsvkgrftiyrdnykntvylqmnslkpedtavyycnaddlmidrdywgqgtqvtvssgs
    eqkliseedlnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbeB (B:)
    vkleesggglvqaggslrlscaasgssiytmgwfrqapgkerefvadiswnggstyyads
    vkgrftiyrdnytvylqmnslkpedtavyycnaddlmidrdywgqgtqvtvss