PDB entry 6dbd

View 6dbd on RCSB PDB site
Description: Crystal Structure of VHH R326
Class: immune system
Keywords: nanobody VHH Listeria, IMMUNE SYSTEM
Deposited on 2018-05-03, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nanobody VHH R326
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBD (0-End)
    Domains in SCOPe 2.07: d6dbda_
  • Chain 'B':
    Compound: nanobody VHH R326
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBD (0-End)
    Domains in SCOPe 2.07: d6dbdb_
  • Chain 'C':
    Compound: nanobody VHH R326
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBD (0-End)
    Domains in SCOPe 2.07: d6dbdc_
  • Chain 'D':
    Compound: nanobody VHH R326
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DBD (0-End)
    Domains in SCOPe 2.07: d6dbdd1, d6dbdd2
  • Heterogens: NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dbdA (A:)
    qvkleesggglvqaegslrlscvtsgriegillvgwyrqgpgkqrdvvasidrngntryd
    gsaegrftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvssenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbdA (A:)
    qvkleesggglvqaegslrlscvtsgriegillvgwyrqrdvvasidrngntrydgsaeg
    rftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dbdB (B:)
    qvkleesggglvqaegslrlscvtsgriegillvgwyrqgpgkqrdvvasidrngntryd
    gsaegrftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvssenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbdB (B:)
    qvkleesggglvqaegslrlscvtsgriegillvgwyrqgkqrdvvasidrngntrydgs
    aegrftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dbdC (C:)
    qvkleesggglvqaegslrlscvtsgriegillvgwyrqgpgkqrdvvasidrngntryd
    gsaegrftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvssenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbdC (C:)
    qvkleesggglvqaegslrlscvtsgriegillvgwyrqrdvvasidrngntrydgsaeg
    rftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dbdD (D:)
    qvkleesggglvqaegslrlscvtsgriegillvgwyrqgpgkqrdvvasidrngntryd
    gsaegrftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvssenly
    fqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dbdD (D:)
    qvkleesggglvqaegslrlscvtsgriegillvgwyrqrdvvasidrngntrydgsaeg
    rftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvsse