PDB entry 6dbc

View 6dbc on RCSB PDB site
Description: Second bromodomain of Human BRD2 with a Tetrahydroquinoline analogue
Class: Transcription/inhibitor
Keywords: BET, BRD2, bromodomain, Inhibitor, Complex, Transcription, Transcription-inhibitor complex
Deposited on 2018-05-03, released 2019-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (7-114)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d6dbca1, d6dbca2
  • Heterogens: G3J, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6dbcA (A:)
    gshmqdpeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvk
    rkmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd