PDB entry 6db0

View 6db0 on RCSB PDB site
Description: N-Terminal bromodomain of Human BRD2 with a Tetrahydroquinoline analogue
Class: Transcription/Inhibitor
Keywords: BET, BRD2, bromodomain, Inhibitor, Complex, Transcription, Transcription-Inhibitor complex
Deposited on 2018-05-02, released 2019-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6db0a_
  • Chain 'B':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6db0b_
  • Chain 'C':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6db0c_
  • Heterogens: G3J, SO4, EPE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6db0A (A:)
    gshmsnpkkpgrvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmd
    mgtikrrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq
    eeqelvvtipknshkkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6db0A (A:)
    vtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlenny
    ywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6db0B (B:)
    gshmsnpkkpgrvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmd
    mgtikrrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq
    eeqelvvtipknshkkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6db0B (B:)
    pgrvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrle
    nnyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpqeeqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6db0C (C:)
    gshmsnpkkpgrvtnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmd
    mgtikrrlennyywaasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq
    eeqelvvtipknshkkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >6db0C (C:)
    tnqlqylhkvvmkalwkhqfawpfrqpvdavklglpdyhkiikqpmdmgtikrrlennyy
    waasecmqdfntmftncyiynkptddivlmaqtlekiflqkvasmpq