PDB entry 6day

View 6day on RCSB PDB site
Description: Xanthomonas albilineans Dihydropteroate synthase with 4-aminobenzoic acid at 1.65 A
Class: transferase
Keywords: pABA, TRANSFERASE
Deposited on 2018-05-02, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Xanthomonas albilineans GPE PC73 [TaxId:380358]
    Gene: folP, XALc_1165
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6daya_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Xanthomonas albilineans GPE PC73 [TaxId:380358]
    Gene: folP, XALc_1165
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dayb_
  • Chain 'C':
    Compound: dihydropteroate synthase
    Species: Xanthomonas albilineans GPE PC73 [TaxId:380358]
    Gene: folP, XALc_1165
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dayc_
  • Chain 'D':
    Compound: dihydropteroate synthase
    Species: Xanthomonas albilineans GPE PC73 [TaxId:380358]
    Gene: folP, XALc_1165
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6dayd_
  • Heterogens: PAB, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dayA (A:)
    mfdtsprldcagriltldrprvmgivnvtpdsfsdggthttveaavahglrlaeegadll
    diggestrpgatavpveeelrrvipvierlvaqtalplsvdtfkpevmraavaagagmin
    dvqalrqpgaldavadlrvpvvlmhmpgdayaagsaphyddvvaevhrflverifaaema
    gidkrrllidpgfgfgkstadnvqllahlprlcelgvpvlaglsrkrsigeltgrelpeq
    rvagsvaahllaaqrgalllrvhdvaatvdaltvwqavqavpsprvatgtampirwpded
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dayA (A:)
    sprldcagriltldrprvmgivnvtpdsfthttveaavahglrlaeegadlldiggesav
    pveeelrrvipvierlvaqtalplsvdtfkpevmraavaagagmindvqalrqpgaldav
    adlrvpvvlmhmpphyddvvaevhrflverifaaemagidkrrllidpgfgfgkstadnv
    qllahlprlcelgvpvlaglsrkrsigeltgrelpeqrvagsvaahllaaqrgalllrvh
    dvaatvdaltvwqavqavp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6dayB (B:)
    mfdtsprldcagriltldrprvmgivnvtpdsfsdggthttveaavahglrlaeegadll
    diggestrpgatavpveeelrrvipvierlvaqtalplsvdtfkpevmraavaagagmin
    dvqalrqpgaldavadlrvpvvlmhmpgdayaagsaphyddvvaevhrflverifaaema
    gidkrrllidpgfgfgkstadnvqllahlprlcelgvpvlaglsrkrsigeltgrelpeq
    rvagsvaahllaaqrgalllrvhdvaatvdaltvwqavqavpsprvatgtampirwpded
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dayB (B:)
    sprldcagriltldrprvmgivnvtpdsfsdggthttveaavahglrlaeegadlldigg
    estrpgatavpveeelrrvipvierlvaqtalplsvdtfkpevmraavaagagmindvqa
    lrqpgaldavadlrvpvvlmhmpphyddvvaevhrflverifaaemagidkrrllidpgf
    gfgkstadnvqllahlprlcelgvpvlaglsrkrsigeltgrelpeqrvagsvaahllaa
    qrgalllrvhdvaatvdaltvwqavqavp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6dayC (C:)
    mfdtsprldcagriltldrprvmgivnvtpdsfsdggthttveaavahglrlaeegadll
    diggestrpgatavpveeelrrvipvierlvaqtalplsvdtfkpevmraavaagagmin
    dvqalrqpgaldavadlrvpvvlmhmpgdayaagsaphyddvvaevhrflverifaaema
    gidkrrllidpgfgfgkstadnvqllahlprlcelgvpvlaglsrkrsigeltgrelpeq
    rvagsvaahllaaqrgalllrvhdvaatvdaltvwqavqavpsprvatgtampirwpded
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dayC (C:)
    dtsprldcagriltldrprvmgivnvtpdsfthttveaavahglrlaeegadlldigges
    vpveeelrrvipvierlvaqtalplsvdtfkpevmraavaagagmindvqalrqpgalda
    vadlrvpvvlmhmpagsaphyddvvaevhrflverifaaemagidkrrllidpgfgfgks
    tadnvqllahlprlcelgvpvlaglsrkrsigeltgrelpeqrvagsvaahllaaqrgal
    llrvhdvaatvdaltvwqavqavp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dayD (D:)
    mfdtsprldcagriltldrprvmgivnvtpdsfsdggthttveaavahglrlaeegadll
    diggestrpgatavpveeelrrvipvierlvaqtalplsvdtfkpevmraavaagagmin
    dvqalrqpgaldavadlrvpvvlmhmpgdayaagsaphyddvvaevhrflverifaaema
    gidkrrllidpgfgfgkstadnvqllahlprlcelgvpvlaglsrkrsigeltgrelpeq
    rvagsvaahllaaqrgalllrvhdvaatvdaltvwqavqavpsprvatgtampirwpded
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dayD (D:)
    tsprldcagriltldrprvmgivnvtpdsfsdggthttveaavahglrlaeegadlldig
    gestrpgatavpveeelrrvipvierlvaqtalplsvdtfkpevmraavaagagmindvq
    alrqpgaldavadlrvpvvlmhmpgdaphyddvvaevhrflverifaaemagidkrrlli
    dpgfgfgkstadnvqllahlprlcelgvpvlaglsrkrsigeltgrelpeqrvagsvaah
    llaaqrgalllrvhdvaatvdaltvwqavqavp