PDB entry 6dam

View 6dam on RCSB PDB site
Description: Crystal structure of lanthanide-dependent methanol dehydrogenase XoxF from Methylomicrobium buryatense 5G
Class: oxidoreductase
Keywords: dehydrogenase, PQQ, methanol, XoxF, lanthanide, lanthanum, methanotroph, OXIDOREDUCTASE
Deposited on 2018-05-01, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lanthanide-dependent methanol dehydrogenase XoxF
    Species: Methylomicrobium buryatense 5G [TaxId:675511]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DAM (Start-616)
    Domains in SCOPe 2.07: d6dama_
  • Heterogens: LA, PQQ, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6damA (A:)
    mkkpvkswliastvaallavpavsqansevekltknpanwatwggnyhgtryselkqint
    snvknlqpawtfstgvlrgheggplvvndvmyihtpfpntvyaidqktqaviweytpqqd
    advtipvmccdtvnrglaygdgkiflqqsdtvltaldaktgkrvwsvqngdpklgmtntq
    aplvvkdkvitgisggefgvrgflaaynirtgeldwkgysmgpdadtlinptktttwkdg
    kvqpvgkdsststwegdqwkigggttwgwysydpelnlvyygsgnpstwnpaqrpgdnkw
    smslwarnadtgevkwvyqmtphdewdydginevalvdqeikgqmrktavhfdrngfgyt
    ldrvtgellvaekfdkavnwashvdmksgrpqvvsqysteyngedvntegvcpaalgskn
    qqpvsyspqtgyfyisgnhvcmdyepfeveytagqpyvgatlsmfpagkdvitgkedgsn
    nlgqftawdattgkiiwsnkeqfsvwsgslataggvvfygtlegylkavdaktgkelyrf
    ktpsgiignvntweyegkqyvgvlsgvggwagigiaagldsgeessnseglgavgayrsl
    ssytklggtltvfalpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6damA (A:)
    nsevekltknpanwatwggnyhgtryselkqintsnvknlqpawtfstgvlrgheggplv
    vndvmyihtpfpntvyaidqktqaviweytpqqdadvtipvmccdtvnrglaygdgkifl
    qqsdtvltaldaktgkrvwsvqngdpklgmtntqaplvvkdkvitgisggefgvrgflaa
    ynirtgeldwkgysmgpdadtlinptktttwkdgkvqpvgkdsststwegdqwkigggtt
    wgwysydpelnlvyygsgnpstwnpaqrpgdnkwsmslwarnadtgevkwvyqmtphdew
    dydginevalvdqeikgqmrktavhfdrngfgytldrvtgellvaekfdkavnwashvdm
    ksgrpqvvsqysteyngedvntegvcpaalgsknqqpvsyspqtgyfyisgnhvcmdyep
    feveytagqpyvgatlsmfpagkdvitgkedgsnnlgqftawdattgkiiwsnkeqfsvw
    sgslataggvvfygtlegylkavdaktgkelyrfktpsgiignvntweyegkqyvgvlsg
    vggwslssytklggtltvfalpn