PDB entry 6d9y

View 6d9y on RCSB PDB site
Description: Crystal structure of a short chain dehydrogenase/reductase SDR from Burkholderia phymatum with partially occupied NAD
Class: oxidoreductase
Keywords: SSGCID, oxidoreductase, short chain dehydrogenase/reductase family, NAD, Burkholderia phymatum, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2018-04-30, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: Bphy_3470
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2JLJ0 (8-257)
      • expression tag (7)
    Domains in SCOPe 2.08: d6d9ya1, d6d9ya2
  • Chain 'B':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) [TaxId:391038]
    Gene: Bphy_3470
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2JLJ0 (8-257)
      • expression tag (7)
    Domains in SCOPe 2.08: d6d9yb1, d6d9yb2
  • Heterogens: EDO, OXM, FMT, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d9yA (A:)
    mahhhhhhmnridlegrvvvitggargigyavaqralrsgaavalwdldaerlarserel
    aelgkvcavtvdqtkeaqieaavgktlaafgaidvlincagitggngttwelepdvwrqv
    idvnligpylvcravvpqmlkqgygrivniasvagkegnpnashysaskagligltkslg
    kelatknilvnavtpaaakteifdsmkqehidymlskipmnrfllpdeaaslilwlgsed
    cafstgsvfdlsggraty
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d9yA (A:)
    hmnridlegrvvvitggargigyavaqralrsgaavalwdldaerlarserelaelgkvc
    avtvdqtkeaqieaavgktlaafgaidvlincagitggngttwelepdvwrqvidvnlig
    pylvcravvpqmlkqgygrivniasvagkegnpnashysaskagligltkslgkelatkn
    ilvnavtpaaakteifdsmkqehidymlskipmnrfllpdeaaslilwlgsedcafstgs
    vfdlsggraty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d9yB (B:)
    mahhhhhhmnridlegrvvvitggargigyavaqralrsgaavalwdldaerlarserel
    aelgkvcavtvdqtkeaqieaavgktlaafgaidvlincagitggngttwelepdvwrqv
    idvnligpylvcravvpqmlkqgygrivniasvagkegnpnashysaskagligltkslg
    kelatknilvnavtpaaakteifdsmkqehidymlskipmnrfllpdeaaslilwlgsed
    cafstgsvfdlsggraty
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d9yB (B:)
    hmnridlegrvvvitggargigyavaqralrsgaavalwdldaerlarserelaelgkvc
    avtvdqtkeaqieaavgktlaafgaidvlincagitggngttwelepdvwrqvidvnlig
    pylvcravvpqmlkqgygrivniasvagkegnpnashysaskagligltkslgkelatkn
    ilvnavtpaaakteifdsmkqehidymlskipmnrfllpdeaaslilwlgsedcafstgs
    vfdlsggraty