PDB entry 6d9q

View 6d9q on RCSB PDB site
Description: The sulfate-bound crystal structure of HPRT (hypoxanthine phosphoribosyltransferase)
Class: transferase
Keywords: HPRT, hypoxanthine phosphoribosyltransferase, TRANSFERASE
Deposited on 2018-04-30, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine phosphoribosyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: hpt, hprT, hpt1, tilS, BA_0063, A9486_05730, ABW01_27435, BASH2_00187, BVG01_28865, CN272_24955, CN488_12230, CN504_22375, COE56_22980, COJ30_24475, COK92_19380, COL95_25280, MCCC1A01412_27610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d9qa1, d6d9qa2
  • Chain 'B':
    Compound: hypoxanthine phosphoribosyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: hpt, hprT, hpt1, tilS, BA_0063, A9486_05730, ABW01_27435, BASH2_00187, BVG01_28865, CN272_24955, CN488_12230, CN504_22375, COE56_22980, COJ30_24475, COK92_19380, COL95_25280, MCCC1A01412_27610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d9qb1, d6d9qb2
  • Chain 'C':
    Compound: hypoxanthine phosphoribosyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: hpt, hprT, hpt1, tilS, BA_0063, A9486_05730, ABW01_27435, BASH2_00187, BVG01_28865, CN272_24955, CN488_12230, CN504_22375, COE56_22980, COJ30_24475, COK92_19380, COL95_25280, MCCC1A01412_27610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d9qc1, d6d9qc2
  • Chain 'D':
    Compound: hypoxanthine phosphoribosyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: hpt, hprT, hpt1, tilS, BA_0063, A9486_05730, ABW01_27435, BASH2_00187, BVG01_28865, CN272_24955, CN488_12230, CN504_22375, COE56_22980, COJ30_24475, COK92_19380, COL95_25280, MCCC1A01412_27610
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d9qd1, d6d9qd2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6d9qA (A:)
    snammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtd
    tylemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfky
    rkaksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsv
    ysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d9qA (A:)
    ammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdty
    lemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrk
    aksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d9qB (B:)
    snammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtd
    tylemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfky
    rkaksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsv
    ysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d9qB (B:)
    ammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdty
    lemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrk
    aksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6d9qC (C:)
    snammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtd
    tylemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfky
    rkaksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsv
    ysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d9qC (C:)
    ammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdty
    lemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrk
    aksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6d9qD (D:)
    snammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtd
    tylemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfky
    rkaksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsv
    ysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d9qD (D:)
    ammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdty
    lemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrk
    aksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys