PDB entry 6d9o

View 6d9o on RCSB PDB site
Description: NMR solution structure of tamapin, mutant E25A
Class: toxin
Keywords: Tamapin mutant, E25A, CSalpha/beta, SK channels, TOXIN
Deposited on 2018-04-30, released 2019-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 5.4
    Species: Mesobuthus tamulus [TaxId:34647]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59869 (0-30)
      • engineered mutation (24)
    Domains in SCOPe 2.08: d6d9oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d9oA (A:)
    afcnlrrcelscrslgllgkcigeackcvpy