PDB entry 6d9i

View 6d9i on RCSB PDB site
Description: Pekin duck egg lysozyme isoform II (DEL-II)
Class: hydrolase
Keywords: lysozyme, hydrolase
Deposited on 2018-04-30, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d9ia_
  • Chain 'B':
    Compound: lysozyme
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6d9ib_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d9iA (A:)
    kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
    rwwcddgktprsknacgipcsvllrsditeavrcakrivsdgngmnawvawrnrcrgtdv
    skwirgcrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6d9iB (B:)
    kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
    rwwcddgktprsknacgipcsvllrsditeavrcakrivsdgngmnawvawrnrcrgtdv
    skwirgcrl